Telian sähköpostin webmailissa vikaa

  • 27 September 2020
  • 18 kommenttia
  • 20 katselukertaa









































Häiriön alkamisaika: 27.09.2020 09:00:00



Sähköpostiin kirjautuminen ei toimi normaalisti selaimilla osoitteesta webmail.inet.fi tai telia.fi kautta. Sähköpostiohjelmien kautta sähköposti toimii normaalisti. Vika pyritään korjaamaan mahdollisimman nopeasti.



Pahoittelemme häiriötä.
Telia



 



Edit HannaMarikaL: Täsmennetty otsikkoa












18 kommenttia


@velirytky@  kirjoitti:

 

TELIAN SÄHKÖPOSTIN WEBMAILISSA VIKAA

Häiriön alkamisaika: 27.09.2020 09:00:00

Sähköpostiin kirjautuminen ei toimi normaalisti selaimilla osoitteesta webmail.inet.fi tai telia.fi kautta. Sähköpostiohjelmien kautta sähköposti toimii normaalisti. Vika pyritään korjaamaan mahdollisimman nopeasti.

Pahoittelemme häiriötä.
Telia


 

Minua yhteisön kunniamerkki ei pahemmin innosta .Se on täysin tarpeeton. Tärkeintä oli saada wbmail ja sähköpostini kokonaisuudessaantoimimaan - ja pian. Olen turhaan tarkastanut asetuksiani ja salasanoja. NE OVAT OLLEET KOKO AJAN KUNNOSSA. Olsi pitänyt arvata syys, vaikkakin kone käyttäytyi kuin se olisi ollut viruksen tartuttama - oli kuitenkin täysin puhdas.

Vielä kaino pyyntö; lopettakaa höpinät "kunniamerkeistä - ne voi poistaa.


@velirytky@  kirjoitti:






































 



TELIAN SÄHKÖPOSTIN WEBMAILISSA VIKAA

Häiriön alkamisaika: 27.09.2020 09:00:00



Sähköpostiin kirjautuminen ei toimi normaalisti selaimilla osoitteesta webmail.inet.fi tai telia.fi kautta. Sähköpostiohjelmien kautta sähköposti toimii normaalisti. Vika pyritään korjaamaan mahdollisimman nopeasti.



Pahoittelemme häiriötä.
Telia



 



Edit HannaMarikaL: Täsmennetty otsikkoa
















Toimiko sähköposti tosiaan eilen 27.9.2020 normaalisti sähköpostiohjelmien kautta? Minun sähköpostini ei kyllä toiminut normaalisti Thunderbirdin avulla, vaan toistamiseen meni jumiin ja katkaisi(?) yhteyden sekä suoritti aikakatkaisuja. Webmailin avulla takelteli ja odotutti latautumista samoin toistamiseen.



Kokeilin luonnollisesti myös koneen uudelleen käynnistymisiä. Lienevätkö auttaneet tai olleet auttamatta, mutta välillä kyllä sain yhteyden takaisin.



 



Sain muuten webmailin posteissa tuli sähköpostin Esikatselu-ikkunassa valinnalla Lisätietoja - Näytä otsikot esille omituisia tekstirivejä, joiden mukaan minulle tulleiden sähköpostien "taustatiedoissa" oli muiden ihmisten(?) sähköpostiosoitteita. Kopsaan tähän alle pätkän tuollaisesta tekstisatsista.



"...



Return-Path: <@gmail.com>
Original-Recipient: rfc822;@pp.inet.fi
Received: from .inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
@id 5D3966B60448635C for @pp.inet.fi; Sun, 27 Sep 2020 16:14:24 +0300
Received-SPF: pass (.inet.fi: domain gmail.com designates
x as permitted sender) identity=mailfrom;
receiver=.inet.fi; client-ip=x
Neljäs kokeilu, gmailista
27/09/2020 - 16:14
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
Lisätietoja
Vastaanottaja:

Piilota otsikot



Return-Path: <@gmail.com>
Original-Recipient: x@pp.inet.fi
Received: from j.inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
@id 5D3966B60448635C for @pp.inet.fi; Sun, 27 Sep 2020 16:14:24 +0300
Received-SPF: pass (.inet.fi: domain gmail.com designates
x as permitted sender) identity=mailfrom;
receiver=.inet.fi; client-ip=x
envelope-from=@gmail.com; helo=mail-wr1-f54.google.com;



..."



 



Edit HannaMarikaL: Lyhennetty lainausta ja poistettu henkilökohtaisia tietoja


@ipapi  kirjoitti:

Toimiko sähköposti tosiaan eilen 27.9.2020 normaalisti sähköpostiohjelmien kautta? Minun sähköpostini ei kyllä toiminut normaalisti Thunderbirdin avulla, vaan toistamiseen meni jumiin ja katkaisi(?) yhteyden sekä suoritti aikakatkaisuja. Webmailin avulla takelteli ja odotutti latautumista samoin toistamiseen.



Kokeilin luonnollisesti myös koneen uudelleen käynnistymisiä. Lienevätkö auttaneet tai olleet auttamatta, mutta välillä kyllä sain yhteyden takaisin.



 



Sain muuten webmailin posteissa tuli sähköpostin Esikatselu-ikkunassa valinnalla Lisätietoja - Näytä otsikot esille omituisia tekstirivejä, joiden mukaan minulle tulleiden sähköpostien "taustatiedoissa" oli muiden ihmisten(?) sähköpostiosoitteita. Kopsaan tähän alle pätkän tuollaisesta tekstisatsista.



"...



Return-Path: <"mää3"@gmail.com>
Original-Recipient: "mää"@pp.inet.fi
Received: from johanna2.inet.fi (10.16.62.34) by vir-isto7.rokki.sonera.fi (x)
id 5D3966B60448635C for "mää"@pp.inet.fi; Sun, 27 Sep 2020 16:14:24 +0300
Received-SPF: pass (johanna2.inet.fi: domain gmail.com designates
x as permitted sender) identity=mailfrom;
receiver=johanna2.inet.fi; client-ip=x
Neljäs kokeilu, gmailista
27/09/2020 - 16:14
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
"Mää"Lisätietoja
Vastaanottaja:
"Mää"
Piilota otsikot



Return-Path: <"mää3"@gmail.com>
Original-Recipient: rfc822;"mää"@pp.inet.fi
Received: from johanna2.inet.fi (x) in gmail.com designates
x as permitted sender) identity=mailfrom;
receiver=johanna2.inet.fi; client-ip=x
envelope-from="mää3"@gmail.com; helo=mail-wr1-f54.google.com;



..."






Karkasi äsken liian selvin omin tiedoin, mutta älkää olko huomaavinanne ja älkää kertoko kenellekään. Taas se meni kesken editoinnin



 



Edit HannaMarikaL: Lyhennetty lainausta ja poistettu allekirjoitus

Käyttäjätaso 1
Kunniamerkki +13

@velirytky@  kirjoitti:












































 



TELIAN SÄHKÖPOSTIN WEBMAILISSA VIKAA

Häiriön alkamisaika: 27.09.2020 09:00:00



Sähköpostiin kirjautuminen ei toimi normaalisti selaimilla osoitteesta webmail.inet.fi tai telia.fi kautta. Sähköpostiohjelmien kautta sähköposti toimii normaalisti. Vika pyritään korjaamaan mahdollisimman nopeasti.



Pahoittelemme häiriötä.
Telia



 



Edit HannaMarikaL: Täsmennetty otsikkoa
















Tänään tuli tietoomme, että eilen illalla on sähköpostia vaivannut häiriö saatu korjattua. 


@ipapi@  kirjoitti:



@velirytky@  kirjoitti:












































 



TELIAN SÄHKÖPOSTIN WEBMAILISSA VIKAA

Häiriön alkamisaika:27.09.2020 09:00:00



Sähköpostiin kirjautuminen ei toimi normaalisti selaimilla osoitteesta webmail.inet.fi tai telia.fi kautta. Sähköpostiohjelmien kautta sähköposti toimii normaalisti. Vika pyritään korjaamaan mahdollisimman nopeasti.



Pahoittelemme häiriötä.
Telia



 



Edit HannaMarikaL: Täsmennetty otsikkoa
















Toimiko sähköposti tosiaan eilen 27.9.2020 normaalisti sähköpostiohjelmien kautta? Minun sähköpostini ei kyllä toiminut normaalisti Thunderbirdin avulla, vaan toistamiseen meni jumiin ja katkaisi(?) yhteyden sekä suoritti aikakatkaisuja. Webmailin avulla takelteli ja odotutti latautumista samoin toistamiseen.



Kokeilin luonnollisesti myös koneen uudelleen käynnistymisiä. Lienevätkö auttaneet tai olleet auttamatta, mutta välillä kyllä sain yhteyden takaisin.



 



Sain muuten webmailin posteissa tuli sähköpostin Esikatselu-ikkunassa valinnalla Lisätietoja - Näytä otsikot esille omituisia tekstirivejä, joiden mukaan minulle tulleiden sähköpostien "taustatiedoissa" oli muiden ihmisten(?) sähköpostiosoitteita. Kopsaan tähän alle pätkän tuollaisesta tekstisatsista.



"...



Return-Path: <@gmail.com>
Original-Recipient: x@pp.inet.fi
Received: from .inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
@id 5D3966B60448635C for @pp.inet.fi; Sun, 27 Sep 2020 16:14:24 +0300
Received-SPF: pass (.inet.fi: domain gmail.com designates
x4 as permitted sender) identity=mailfrom;
receiver=.inet.fi; client-ip=x
Neljäs kokeilu, gmailista
27/09/2020 - 16:14
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
Lisätietoja
Vastaanottaja:

Piilota otsikot



Return-Path: <@gmail.com>
Original-Recipient: x@pp.inet.fi
Received: from j.inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
@id 5D3966B60448635C for @pp.inet.fi; Sun, 27 Sep 2020 16:14:24 +0300
Received-SPF: pass (.inet.fi: domain gmail.com designates
x as permitted sender) identity=mailfrom;
receiver=.inet.fi; client-ip=x
envelope-from=@gmail.com; helo=mail-wr1-f54.google.com;



..."



 



Edit HannaMarikaL: Lyhennetty lainausta ja poistettu henkilökohtaisia tietoja






Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.



 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)

Käyttäjätaso 4
Kunniamerkki +13

@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)






Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.


@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?

 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)


Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.


Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!

Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?

Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?

 

 

Käyttäjätaso 4
Kunniamerkki +13

@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)






Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.






Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!



Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?



Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?



 



 






Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 


@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:

@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?

 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)


Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.


Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!

Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?

Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?

 

 


Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 


Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.

Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:

 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai

 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai

 - asialle löytyy viaton ja hyväksyttävä selitys

 

Käyttäjätaso 3
Kunniamerkki +9

@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)






Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.






Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!



Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?



Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?



 



 






Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 






Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.



Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:



 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai



 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai



 - asialle löytyy viaton ja hyväksyttävä selitys



 






Jos olet osana jakelulistaa, voi olla mahdollista nähdä esikatselussa muidenkin saman viestin vastaanottajan sähköpostiosoite, joka jakelulistalla on. Tämän jakelun lähettäjä voi viestiä lähettäessä määritellä, voiko viestin vastaanottajat nähdä, kenelle muulle viesti on mennyt.


@HenriLie@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)






Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.






Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!



Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?



Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?



 



 






Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 






Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.



Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:



 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai



 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai



 - asialle löytyy viaton ja hyväksyttävä selitys



 






Jos olet osana jakelulistaa, voi olla mahdollista nähdä esikatselussa muidenkin saman viestin vastaanottajan sähköpostiosoite, joka jakelulistalla on. Tämän jakelun lähettäjä voi viestiä lähettäessä määritellä, voiko viestin vastaanottajat nähdä, kenelle muulle viesti on mennyt.






Enpä ole noissa mainitsemissani viesteissä osana mitään jakelulistaa, sillä yritin toissa yönä ja eilen saada tolkkua sähköpostin takkuiluista ja lähetin itselleni (siis vain itselleni) kokeiluposteja.



Kopioin alle tuota postin taustatietotekstiä (Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot).



Omat tiedot olen korvannut merkkijonolla "MÄÄ". Tekstiin on voinut tulla Muistion automaattisen riveillejaon vuoksi ylimääräisiä riveille jakoja.




OMA KOKEILU 26.9.2020
26/09/2020 - 23:44
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
"MÄÄ"Lisätietoja
Vastaanottaja:
"MÄÄ"@pp.inet.fi
Piilota otsikot



Return-Path: <"MÄÄ"@pp.inet.fi>
Original-Recipient: rfc822;"MÄÄ"@pp.inet.fi
Received: from johanna3.inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
id 5D3966B604467894 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
X-RazorGate-Vade-Verdict: clean 15
X-RazorGate-Vade-Classification: clean
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedujedrvddvgdduheegucetufdoteggodetrfdotffvucfrrhhofhhil
Received: from x by johanna3.inet.fi (x)
id 5F6FA69900000860 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
From: "MÄÄ" <"MÄÄ"@pp.inet.fi>
To: <"MÄÄ"@pp.inet.fi>
Subject: OMA KOKEILU 26.9.2020
Date: Sat, 26 Sep 2020 23:44:00 +0300
Message-ID: <000001d69445$c3699860$4a3cc920$@pp.inet.fi>
MIME-Version: 1.0
Content-Type: text/plain;
charset="us-ascii"
Content-Transfer-Encoding: 7bit
X-Mailer: Microsoft Outlook 14.0
Thread-Index: AdaURbQkCSWEA0qYSl2oqzQFkT3Ojw==
Content-Language: fi



 



Edit ReOlivia: Lyhennetty hieman ja poistettu yksilöiviä tietoja

Käyttäjätaso 3
Kunniamerkki +9

@ipapi@  kirjoitti:



@HenriLie@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)






Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.






Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!



Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?



Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?



 



 






Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 






Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.



Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:



 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai



 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai



 - asialle löytyy viaton ja hyväksyttävä selitys



 






Jos olet osana jakelulistaa, voi olla mahdollista nähdä esikatselussa muidenkin saman viestin vastaanottajan sähköpostiosoite, joka jakelulistalla on. Tämän jakelun lähettäjä voi viestiä lähettäessä määritellä, voiko viestin vastaanottajat nähdä, kenelle muulle viesti on mennyt.






Enpä ole noissa mainitsemissani viesteissä osana mitään jakelulistaa, sillä yritin toissa yönä ja eilen saada tolkkua sähköpostin takkuiluista ja lähetin itselleni (siis vain itselleni) kokeiluposteja.



Kopioin alle tuota postin taustatietotekstiä (Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot).



Omat tiedot olen korvannut merkkijonolla "MÄÄ". Tekstiin on voinut tulla Muistion automaattisen riveillejaon vuoksi ylimääräisiä riveille jakoja.




OMA KOKEILU 26.9.2020
26/09/2020 - 23:44
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
"MÄÄ"Lisätietoja
Vastaanottaja:
"MÄÄ"@pp.inet.fi
Piilota otsikot



Return-Path: <"MÄÄ"@pp.inet.fi>
Original-Recipient: rfc822;"MÄÄ"@pp.inet.fi
Received: from johanna3.inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
id 5D3966B604467894 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
X-RazorGate-Vade-Verdict: clean 15
X-RazorGate-Vade-Classification: clean
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedujedrvddvgdduheegucetufdoteggodetrfdotffvucfrrhh
Received: from x (x) by johanna3.inet.fi (x)
id 5F6FA69900000860 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
From: "MÄÄ" <"MÄÄ"@pp.inet.fi>
To: <"MÄÄ"@pp.inet.fi>
Subject: OMA KOKEILU 26.9.2020
Date: Sat, 26 Sep 2020 23:44:00 +0300
Message-ID: <000001d69445$c3699860$4a3cc920$@pp.inet.fi>
MIME-Version: 1.0
Content-Type: text/plain;
charset="us-ascii"
Content-Transfer-Encoding: 7bit
X-Mailer: Microsoft Outlook 14.0
Thread-Index: AdaURbQkCSWEA0qYSl2oqzQFkT3Ojw==
Content-Language: fi



 






Tarkoitatko tässä osoitetta johanna3.inet.fi, että se olisi osoite mihin viestisi menee? Tämä on vain meidän palvelimen nimi, mistä posti sinulle saapuu, ei kenenkään henkilön sähköposti.

Eipä toimi kaikin osin vieläkään. Salasanat eivät toimi kaikin osin, eikä niitä pysty edes vaihtamaan. Hyvin pyyhkii Telialla.

 


@HenriLie@  kirjoitti:

@ipapi@  kirjoitti:

@HenriLie@  kirjoitti:

@ipapi@  kirjoitti:

@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:

@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?

 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)


Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.


Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!

Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?

Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?

 

 


Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 


Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.

Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:

 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai

 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai

 - asialle löytyy viaton ja hyväksyttävä selitys

 


Jos olet osana jakelulistaa, voi olla mahdollista nähdä esikatselussa muidenkin saman viestin vastaanottajan sähköpostiosoite, joka jakelulistalla on. Tämän jakelun lähettäjä voi viestiä lähettäessä määritellä, voiko viestin vastaanottajat nähdä, kenelle muulle viesti on mennyt.


Enpä ole noissa mainitsemissani viesteissä osana mitään jakelulistaa, sillä yritin toissa yönä ja eilen saada tolkkua sähköpostin takkuiluista ja lähetin itselleni (siis vain itselleni) kokeiluposteja.

Kopioin alle tuota postin taustatietotekstiä (Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot).

Omat tiedot olen korvannut merkkijonolla "MÄÄ". Tekstiin on voinut tulla Muistion automaattisen riveillejaon vuoksi ylimääräisiä riveille jakoja.


OMA KOKEILU 26.9.2020
26/09/2020 - 23:44
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
"MÄÄ"Lisätietoja
Vastaanottaja:
"MÄÄ"@pp.inet.fi
Piilota otsikot

Return-Path: <"MÄÄ"@pp.inet.fi>
Original-Recipient: rfc822;"MÄÄ"@pp.inet.fi
Received: from johanna3.inet.fi (10.16.62.35) by vir-isto7.rokki.sonera.fi (8.6.150)
id 5D3966B604467894 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
X-RazorGate-Vade-Verdict: clean 15
X-RazorGate-Vade-Classification: clean
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedujedrvddvgdduheegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftnecuuegrihhlohhuthemuceftddtnecuogetfedtuddqtdduucdludehmdenucfjughrpefhvffufffkgggtgffothesthejghdtvddtvdenucfhrhhomhepfdfluhhhrghnihcunfgrhhhtihhnvghnfdcuoehjuhhhrghnihdrlhgrhhhtihhnvghnsehpphdrihhnvghtrdhfiheqnecuggftrfgrthhtvghrnhepheefleetgfeuvddttdeitdelgefglefgvdeiheegtdelhedugeffkedvffdtgfdtnecukfhppeektddrvddvfedrieeirddufeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopefntefrvffqrfflhefujfffqffpgfdpihhnvghtpeektddrvddvfedrieeirddufedpmhgrihhlfhhrohhmpeeolhgrhhhtjhhuqdejsehmsghogidrihhnvghtrdhfiheqpdhrtghpthhtohepoehlrghhthhjuhdqjeesmhgsohigrdhinhgvthdrfhhiqecuqfftvefrvfeprhhftgekvddvnehjuhhhrghnihdrlhgrhhhtihhnvghnsehpphdrihhnvghtrdhfih
Received: from LAPTOPJ5SHDONE (80.223.66.13) by johanna3.inet.fi (9.0.019.26-1)
id 5F6FA69900000860 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
From: "MÄÄ" <"MÄÄ"@pp.inet.fi>
To: <"MÄÄ"@pp.inet.fi>
Subject: OMA KOKEILU 26.9.2020
Date: Sat, 26 Sep 2020 23:44:00 +0300
Message-ID: <000001d69445$c3699860$4a3cc920$@pp.inet.fi>
MIME-Version: 1.0
Content-Type: text/plain;
charset="us-ascii"
Content-Transfer-Encoding: 7bit
X-Mailer: Microsoft Outlook 14.0
Thread-Index: AdaURbQkCSWEA0qYSl2oqzQFkT3Ojw==
Content-Language: fi

 


Tarkoitatko tässä osoitetta johanna3.inet.fi, että se olisi osoite mihin viestisi menee? Tämä on vain meidän palvelimen nimi, mistä posti sinulle saapuu, ei kenenkään henkilön sähköposti.


Itse asiassa en tarkoita mitään, vaan haluan tietää ja kysyn, että mitä nuo tarkoittavat.

Siellä on myös osoite vir-isto7.rokki.sonera.fi, joka lienee samaa seuraa tuon Johannan kanssa?

Niinpä meni lähimmäksi arvaukseni sentraalin Santrasta tuon Johannan osalta. Tuo Rokki-Isto -niminen hemmo lienee myös konehemmo?


@rat77am@  kirjoitti:


Eipä toimi kaikin osin vieläkään. Salasanat eivät toimi kaikin osin, eikä niitä pysty edes vaihtamaan. Hyvin pyyhkii Telialla.



 






Uuden salasanan pystyt tilaamaan sähköpostillesi täältä, jos olet liittänyt matkapuhelinnumeron tiliisi. Muussa tapauksessa täytyy tämä salasana uusia asiakaspalvelustamme, joten sieltä viimekädessä saat avun tähän. Kun sinulla on uusi salasana, voit vaihtaa sen itsepalveluna kirjautumalla Minun Teliaan telia.fi-sivuilla. Ohjeita salasanan vaihtamiseen löydät sivuiltamme kootusti. 


@HenriLie@  kirjoitti:

@ipapi@  kirjoitti:

@HenriLie@  kirjoitti:

@ipapi@  kirjoitti:

@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:

@HannaMarikaL@  kirjoitti:

@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?

 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)


Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.


Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!

Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?

Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?

 

 


Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 


Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.

Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:

 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai

 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai

 - asialle löytyy viaton ja hyväksyttävä selitys

 


Jos olet osana jakelulistaa, voi olla mahdollista nähdä esikatselussa muidenkin saman viestin vastaanottajan sähköpostiosoite, joka jakelulistalla on. Tämän jakelun lähettäjä voi viestiä lähettäessä määritellä, voiko viestin vastaanottajat nähdä, kenelle muulle viesti on mennyt.


Enpä ole noissa mainitsemissani viesteissä osana mitään jakelulistaa, sillä yritin toissa yönä ja eilen saada tolkkua sähköpostin takkuiluista ja lähetin itselleni (siis vain itselleni) kokeiluposteja.

Kopioin alle tuota postin taustatietotekstiä (Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot).

Omat tiedot olen korvannut merkkijonolla "MÄÄ". Tekstiin on voinut tulla Muistion automaattisen riveillejaon vuoksi ylimääräisiä riveille jakoja.


OMA KOKEILU 26.9.2020
26/09/2020 - 23:44
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
"MÄÄ"Lisätietoja
Vastaanottaja:
"MÄÄ"@pp.inet.fi
Piilota otsikot

Return-Path: <"MÄÄ"@pp.inet.fi>
Original-Recipient: rfc822;"MÄÄ"@pp.inet.fi
Received: from johanna3.inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
id 5D3966B604467894 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
X-RazorGate-Vade-Verdict: clean 15
X-RazorGate-Vade-Classification: clean
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedujedrvddvgdduheegucetufdoteggodetrfdotffvucfrrhh
Received: from x (x) by johanna3.inet.fi (x)
id 5F6FA69900000860 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
From: "MÄÄ" <"MÄÄ"@pp.inet.fi>
To: <"MÄÄ"@pp.inet.fi>
Subject: OMA KOKEILU 26.9.2020
Date: Sat, 26 Sep 2020 23:44:00 +0300
Message-ID: <000001d69445$c3699860$4a3cc920$@pp.inet.fi>
MIME-Version: 1.0
Content-Type: text/plain;
charset="us-ascii"
Content-Transfer-Encoding: 7bit
X-Mailer: Microsoft Outlook 14.0
Thread-Index: AdaURbQkCSWEA0qYSl2oqzQFkT3Ojw==
Content-Language: fi

 


Tarkoitatko tässä osoitetta johanna3.inet.fi, että se olisi osoite mihin viestisi menee? Tämä on vain meidän palvelimen nimi, mistä posti sinulle saapuu, ei kenenkään henkilön sähköposti.


Lienee mennyt edellinen lähetykseni eilisiltana jonnekin tyhjyyteen!

En ole tarkoittanut mitään, vaan kysynyt , mistä on kysymys.

Tuo "osoite" tai oikeasti "Received: from johanna3.inet.fi (10.16.62.35) by vir-isto7.rokki.sonera.fi (8.6.150)" näyttäisi enemmänkin nettiosoitteen ja jonkin siellä toimivan henkilön tiedoilta. Kommenttisi mukaan ne siis kertovat Telian palvelimesta jne.

Juuri tuota tiedon "oikeutusperustaa" halusinkin tietää silloin, kun en vielä ollut nähnyt noita runsaita tietoja Telian sähköpostien ongelmista. Silloin oli mahdollisuutena sekin, että jokin kolmas taho toimii hidastavasti juuri minun sähköpostieni kimpussa, mikä olisi toki ollut melko omituista. Nyt tiedän (oletan), että kolmatta, hidastavaa tahoa ei ole, vaan että hidasteet tulevat (mahdollisesti) Telian ongelmista.

Käyttäjätaso 1
Kunniamerkki +9

@ipapi@  kirjoitti:



@HenriLie@  kirjoitti:



@ipapi@  kirjoitti:



@HenriLie@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:



@HannaMarikaL@  kirjoitti:



@ipapi@  kirjoitti:
Monet kiitokset henkilötietojen poistamisesta. Niitä meni tekstiin sensuroimattomina vahingossa.

 - Onko muuten keinoa päästä itse muuttamaan varkain lähtenyttä tekstiä?



 - Miten (millä nappulalla tms.) tämän tekstin itse asiassa saa lähtemään vain silloin kun sen itse haluaa lähettää. (Pitäisikö oma teksti ensin tehdä vaikka Muistiossa  ja korjailla siellä?)






Omia viestejään pystyy muokkaamaan kahden tunnin ajan, mikäli on laittanut sellaista tietoa, jota ei haluakaan viestiin laittaa tai tulee vaikkapa kirjoitusvirhe, jonka haluaa korjata. Ja viestiä kirjoittaessa, alhaalla on tuo vastaa-nappi. Siitä kun painaa, lähtee viesti saman tien. Viesti ei kuitenkaan lähde ennen kuin tuota nappia on painettu.






Vastaa-nappi -- Vastauksen kirjoitus. -- Vastaa-nappi!



Voisiko olla: Vastaa-nappi -- Vastauksen kirjoitus. -- Lähetä-nappi?



Tuon jälkimmäisen minäkin ymmärtäisin: Toki nytkin on tuo ensimmäinen Vastaa-nappi vasemmalla, ja tuo toinen Vastaa-nappi oikealla (ainakin minulla Firefoxissa), ja siitäpä sitten voisin minäkin ymmärtää, että vastauksen aloittamiseen pääsee vasemmalta ja sen lähettämiseen pääsee saman näköisellä napilla oikealta. Näin säästänemme nappikaupassa, eikös?



 



 






Tuo Vastaa -nappi tosiaan on sitten oikeassa alareunassa, kun viestiä on päästy jo kirjoittamaan ja siitä painamalla teksti menee julkaisuun. Mutta viedäänpäs tämä toive eteenpäin, josko "vastaa" tilalle saataisiin Lähetä -painike esimerkiksi. 






Tämä vastaamisen tekninen toteutus lienee nyt minullekin selvä, vaikka se Lähetä-painike voisi kyllä vielä olla asiaa.



Se alkuperäinen outo asia - niiden vieraiden sähköpostiosoitteiden lymyäminen minulle tulleiden sähköpostien taustatedoissa Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot - on minulle vielä kummenpi juttu:



 - ne herättävät epäilyn, että joku poimii minulle tulevia viestejä omaan kooppaansa, tai



 - Telian sähköpostin välitystä hoidetaan sentraalin Santran välittämänä, ja tuon Santran tunnistamista varten, EU:n tietoturvamääräysten mahdollisten vaatimusten varalta, täytyy hänen puumerkkinsä postien taakse leimata, tai



 - asialle löytyy viaton ja hyväksyttävä selitys



 






Jos olet osana jakelulistaa, voi olla mahdollista nähdä esikatselussa muidenkin saman viestin vastaanottajan sähköpostiosoite, joka jakelulistalla on. Tämän jakelun lähettäjä voi viestiä lähettäessä määritellä, voiko viestin vastaanottajat nähdä, kenelle muulle viesti on mennyt.






Enpä ole noissa mainitsemissani viesteissä osana mitään jakelulistaa, sillä yritin toissa yönä ja eilen saada tolkkua sähköpostin takkuiluista ja lähetin itselleni (siis vain itselleni) kokeiluposteja.



Kopioin alle tuota postin taustatietotekstiä (Wbmailin Esikatselu-ikkunassa valinnalla Lisätietoja ja senjälkeen vielä valinta Näytä otsikot).



Omat tiedot olen korvannut merkkijonolla "MÄÄ". Tekstiin on voinut tulla Muistion automaattisen riveillejaon vuoksi ylimääräisiä riveille jakoja.




OMA KOKEILU 26.9.2020
26/09/2020 - 23:44
Etsi samanlaiset sähköpostiviestit
Lähettäjä:
"MÄÄ"Lisätietoja
Vastaanottaja:
"MÄÄ"@pp.inet.fi
Piilota otsikot



Return-Path: <"MÄÄ"@pp.inet.fi>
Original-Recipient: rfc822;"MÄÄ"@pp.inet.fi
Received: from johanna3.inet.fi (x) by vir-isto7.rokki.sonera.fi (x)
id 5D3966B604467894 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
X-RazorGate-Vade-Verdict: clean 15
X-RazorGate-Vade-Classification: clean
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedujedrvddvgdduheegucetufdoteggodetrfdotffvucfrrhh
Received: from x (x) by johanna3.inet.fi (x)
id 5F6FA69900000860 for "MÄÄ"@pp.inet.fi; Sat, 26 Sep 2020 23:44:00 +0300
From: "MÄÄ" <"MÄÄ"@pp.inet.fi>
To: <"MÄÄ"@pp.inet.fi>
Subject: OMA KOKEILU 26.9.2020
Date: Sat, 26 Sep 2020 23:44:00 +0300
Message-ID: <000001d69445$c3699860$4a3cc920$@pp.inet.fi>
MIME-Version: 1.0
Content-Type: text/plain;
charset="us-ascii"
Content-Transfer-Encoding: 7bit
X-Mailer: Microsoft Outlook 14.0
Thread-Index: AdaURbQkCSWEA0qYSl2oqzQFkT3Ojw==
Content-Language: fi



 






Tarkoitatko tässä osoitetta johanna3.inet.fi, että se olisi osoite mihin viestisi menee? Tämä on vain meidän palvelimen nimi, mistä posti sinulle saapuu, ei kenenkään henkilön sähköposti.






Lienee mennyt edellinen lähetykseni eilisiltana jonnekin tyhjyyteen!



En ole tarkoittanut mitään, vaan kysynyt , mistä on kysymys.



Tuo "osoite" tai oikeasti "Received: from johanna3.inet.fi (10.16.62.35) by vir-isto7.rokki.sonera.fi (8.6.150)" näyttäisi enemmänkin nettiosoitteen ja jonkin siellä toimivan henkilön tiedoilta. Kommenttisi mukaan ne siis kertovat Telian palvelimesta jne.



Juuri tuota tiedon "oikeutusperustaa" halusinkin tietää silloin, kun en vielä ollut nähnyt noita runsaita tietoja Telian sähköpostien ongelmista. Silloin oli mahdollisuutena sekin, että jokin kolmas taho toimii hidastavasti juuri minun sähköpostieni kimpussa, mikä olisi toki ollut melko omituista. Nyt tiedän (oletan), että kolmatta, hidastavaa tahoa ei ole, vaan että hidasteet tulevat (mahdollisesti) Telian ongelmista.






Kopioimasi tiedot ovat normaalit sähköpostin otsikkotiedot. Otsikkotiedoissa mainitut  johanna3 ja isto-alkuiset ovat Telian sähköpostipalvelimia, joiden kautta viesti on kulkenut. Sähköpostipalvelimia on myös muita, jotka on nimetty samansuuntaisesti, joten katsoessasi toisen sähköpostiviestisi otsikkotietoja, siellä voi näkyä myös erinimisiä palvelimia.

Vastaa